Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Splicing Factor 4 (SF4) antibody

Antigen

Splicing Factor 4 (SF4)

Synonyms RBP, F23858, DKFZp434E2216, Sf4, 5730496N02Rik, SF4, rbp, MGC143307, f23858
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish, Fruit Fly (Drosophila melanogaster)

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN310092
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Gene ID SF4
UniProt Q8IWZ8
Immunogen The immunogen for anti-SF4 antibody: synthetic peptide directed towards the N terminal of human SF4
Sequence MSLKMDNRDVAGKANRWFGVAPPKSGKMNMNILHQEELIA QKKREIEAKM
Cross-Reactivity Cow (Bovine), Dog (Canine), Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-SF4 antibody concentration is 1 mg/ml.
Description SF4 is a member of the SURP family of splicing factors.SF4 is a member of the SURP family of splicing factors.[supplied by OMIM].
Characteristics Antigen Size: 645 amino acids
Molecular Weight 72kDa

Application Details

Application Notes WB Suggested Anti-SF4 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Grimwood, Gordon, Olsen et al.: "The DNA sequence and biology of human chromosome 19." in: Nature, Vol. 428, Issue 6982, pp. 529-35, 2004 (PubMed).

Alternatives

Alternatives for antigen "Splicing Factor 4 (SF4)", type "Antibodies"
Hosts Rabbit (17)
Reactivities Human (13), Mouse (Murine) (6), Rat (Rattus) (4), Cow (Bovine) (1), Dog (Canine) (1), Xenopus laevis (1)
Applications Western Blotting (WB) (15), ELISA (8), Immunohistochemistry (IHC) (1)
Epitopes N-Term (3), C-Term (2), Internal Region (1)