Splicing Factor 4 (SF4) antibody

Antigen: Splicing Factor 4 (SF4)

Synonyms: RBP, F23858, DKFZp434E2216, Sf4, 5730496N02Rik, SF4, rbp, MGC143307, f23858

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish, Fruit Fly (Drosophila melanogaster)

Application: Western Blotting (WB)

Catalog no.: ABIN310092

Additional Information

Gene ID: SF4

UniProt: Q8IWZ8

Immunogen: The immunogen for anti-SF4 antibody: synthetic peptide directed towards the N terminal of human SF4

Sequence: MSLKMDNRDVAGKANRWFGVAPPKSGKMNMNILHQEELIA QKKREIEAKM

Cross-Reactivity: Cow (Bovine), Dog (Canine), Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SF4 antibody concentration is 1 mg/ml.

Description: SF4 is a member of the SURP family of splicing factors.SF4 is a member of the SURP family of splicing factors.[supplied by OMIM].

Characteristics: Antigen Size: 645 amino acids

Molecular Weight: 72kDa

Application Details

Application Notes: WB Suggested Anti-SF4 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-SF4 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Publications

Product: Grimwood, Gordon, Olsen et al.: "The DNA sequence and biology of human chromosome 19." in: Nature, Vol. 428, Issue 6982, pp. 529-35, 2004 (PubMed).