Heterogeneous Nuclear Ribonucleoprotein C (C1/C2) (HNRNPC) antibody

Antigen: Heterogeneous Nuclear Ribonucleoprotein C (C1/C2) (HNRNPC)

Synonyms: C1, C2, HNRNP, HNRPC, SNRPC, MGC104306, MGC105117, MGC117353, MGC131677, MGC53243, MGC128837

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Rabbit

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN310100

Additional Information

Alternative name: HnRNP-C1/C2 / HNRNPC

Gene ID: HNRPC

Immunogen: The immunogen for anti-HNRPC antibody: synthetic peptide directed towards the N terminal of human HNRPC

Sequence: LDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLS SSFDLDYDFQ

Cross-Reactivity: Dog (Canine), Human, Mouse (Murine), Rabbit, Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-HNRPC antibody concentration is 1 mg/ml.

Description: HNRPC belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein can act as a tetramer and is involved in the assembly of 40S hnRNP particles.This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has one RRM domain that binds to RNAs. Two alternatively spliced transcript variants have been described for this gene.

Characteristics: Antigen Size: 303 amino acids

Molecular Weight: 33kDa

Application Details

Application Notes: WB Suggested Anti-HNRPC Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-HNRPC Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate

Publications

Product: Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).