gamma-Glutamyltransferase Light Chain 1 (GGTLC1) antibody

Antigen: gamma-Glutamyltransferase Light Chain 1 (GGTLC1)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Xenopus laevis

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN310187

Additional Information

Alternative name: GGTLC1 / GGTLA4

Gene ID: GGTLA4

UniProt: Q9BX51

Immunogen: The immunogen for anti-GGTLA4 antibody: synthetic peptide directed towards the C terminal of human GGTLA4

Sequence: DQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGWAAASD SRKGGEPAGY

Cross-Reactivity: Dog (Canine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-GGTLA4 antibody concentration is 1 mg/ml.

Description: Gamma-glutamyl transpeptidase is a membrane-bound protein that is important in the metabolism of glutathione. The protein is similar in sequence to several members of the gamma-glutamyl transpeptidase family.Gamma-glutamyl transpeptidase is a membrane-bound protein that is important in the metabolism of glutathione. The protein encoded by this gene is similar in sequence to several members of the gamma-glutamyl transpeptidase family. Three transcript variants encoding the same protein have been found for this gene.

Characteristics: Antigen Size: 225 amino acids

Molecular Weight: 25kDa

Application Details

Application Notes: WB Suggested Anti-GGTLA4 Antibody Titration: 5.0ug/ml
Positive Control: Human kidney.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-GGTLA4 Antibody Titration: 5.0ug/ml
Positive Control: Human kidney

anti-gamma-Glutamyltransferase Light Chain 1 (GGTLC1) antibody (Image 2)

Publications

Product: Luong, Hannah, Brown et al.: "Molecular characterization of human acetyl-CoA synthetase, an enzyme regulated by sterol regulatory element-binding proteins." in: The Journal of biological chemistry, Vol. 275, Issue 34, pp. 26458-66, 2000 (PubMed).