Methyltransferase Like 13 (METTL13) antibody

Antigen: Methyltransferase Like 13 (METTL13)

Synonyms: feat, CGI-01, FLJ10310, KIAA0859, 5630401D24Rik, METTL13, MGC157180, cgi-01, kiaa0859, RGD1311526, mettl13, si:dkey-19f21.2

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN310235

Additional Information

Alternative name: METTL13

Gene ID: KIAA0859

UniProt: Q8N6R0-1

Immunogen: The immunogen for anti-KIAA0859 antibody: synthetic peptide directed towards the C terminal of human KIAA0859

Sequence: NEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDT YVLSDMLKTV

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-KIAA0859 antibody concentration is 1 mg/ml.

Description: The function remains unknown.

Characteristics: Antigen Size: 543 amino acids

Molecular Weight: 60kDa

Application Details

Application Notes: WB Suggested Anti-KIAA0859 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-KIAA0859 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate

Publications

Product: Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).