Collapsin Response Mediator Protein 1 (CRMP1) antibody
| Antigen | Collapsin Response Mediator Protein 1 (CRMP1) |
| Synonyms | DRP1, DRP-1, DPYSL1, CRMP1B, CRMP1, CRMP-1, MGC115310, crmp1, MGC145930, Ulip3, Dpysl1, CRMP 1, PCRMP 1, PCRMP-1, PCRMP1, PfCRMP-1 |
| Clonality | Polyclonal |
| Host |
 Alternatives Rabbit |
| Reactivity |
Alternatives Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Xenopus laevis, Zebrafish, Dog (Canine) |
| Conjugate |
Alternatives Un-conjugated |
| Application |
Alternatives Western Blotting (WB) |
 |
1 reference available |
| Catalog no. | ABIN310255 |
| Quantity | 50 µg (Variants) |
| Price | 317.90 $ Plus shipping costs $45.00 |
| Shipping to |
|
| Availability | Will be delivered in 2 to 3 Business Days |
Additional Information
| Alternative name | CRMP1 / DPYSL1 |
| Gene ID | CRMP1 |
| UniProt | Q14194 |
| Immunogen | The immunogen for anti-CRMP1 antibody: synthetic peptide directed towards the N terminal of human CRMP1 |
| Sequence | MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDG LIKQIGENLI |
| Cross-Reactivity | Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus) |
| Format | Lyophilized |
| Reconstitution | Add 50 µl of distilled water. Final anti-CRMP1 antibody concentration is 1 mg/ml. |
| Description | CRMP1 is a member of a family of cytosolic phosphoproteins expressed exclusively in the nervous system. The protein is thought to be a part of the semaphorin signal transduction pathway implicated in semaphorin-induced growth cone collapse during neural development.This gene encodes a member of a family of cytosolic phosphoproteins expressed exclusively in the nervous system. The encoded protein is thought to be a part of the semaphorin signal transduction pathway implicated in semaphorin-induced growth cone collapse during neural development. Alternative splicing results in multiple transcript variants. |
| Characteristics | Antigen Size: 572 amino acids |
| Molecular Weight | 63kDa |
Application Details
| Application Notes |
WB Suggested Anti-CRMP1 Antibody Titration: 0.2-1 ug/ml Positive Control: HepG2 cell lysate. |
| Purification | Affinity Purified |
| Buffer | PBS |
| Storage (Long Term) | For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Storage (Short Term) | Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. |
| Restrictions | For Research Use only |
Publications
| Product |
Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).
|
Alternatives
Alternatives for antigen "Collapsin Response Mediator Protein 1 (CRMP1)", type "Antibodies"
| Hosts | Rabbit (63), Mouse (3) |
| Reactivities | Human (60), Mouse (Murine) (38), Rat (Rattus) (34), Chicken (21), Cow (Bovine) (21), Dog (Canine) (21), Horse (Equine) (18), Pig (Porcine) (18), Xenopus laevis (2), Zebrafish (2), Cat (Feline) (1) |
| Applications | Western Blotting (WB) (51), ELISA (23), Immunofluorescence (IF) (16), Immunohistochemistry (IHC) (14), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (10), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoprecipitation (IP) (2), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (Frozen Sections) (IHC (fro)) (1) |
| Conjugates | Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1) |
| Epitopes | C-Term (11), N-Term (7), Internal Region (4), AA 76-572 (1), Met50 (1), Middle Region (1), N-Term,AA 81-110 (1) |
