Sarcosine Oxidase antibody

Antigen: Sarcosine Oxidase

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Rabbit, Zebrafish

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN310346

Additional Information

Gene ID: PIPOX

UniProt: Q9P0Z9

Immunogen: The immunogen for anti-PIPOX antibody: synthetic peptide directed towards the C terminal of human PIPOX

Sequence: FVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNI VIGAGFSGHG

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rabbit, Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-PIPOX antibody concentration is 1 mg/ml.

Description: PIPOX metabolizes sarcosine, L-pipecolic acid and L-proline.

Characteristics: Antigen Size: 390 amino acids

Molecular Weight: 43kDa

Application Details

Application Notes: WB Suggested Anti-PIPOX Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-PIPOX Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate

Publications

Product: IJlst, de Kromme, Oostheim et al.: "Molecular cloning and expression of human L-pipecolate oxidase." in: Biochemical and biophysical research communications, Vol. 270, Issue 3, pp. 1101-5, 2000 (PubMed).