Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Chromosome 21 Open Reading Frame 7 (C21orf7) antibody

Antigen

Chromosome 21 Open Reading Frame 7 (C21orf7)

Synonyms TAKL, TAK1L, TAKL-1, TAKL-2, TAKL-4, HC21ORF7
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken

Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN310361
Quantity 0.1 mg
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name TAK1L
Gene ID C21orf7
UniProt P57077
Immunogen The immunogen for anti-C21orf7 antibody: synthetic peptide directed towards the C terminal of human C21orf7
Sequence DSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKL DQAEKEKVDA
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-C21orf7 antibody concentration is 1 mg/ml.
Description C21orf7 plays a critical role in the TGF-beta signaling transduction pathway.
Characteristics Antigen Size: 242 amino acids
Molecular Weight 27kDa

Application Details

Application Notes WB Suggested Anti-C21orf7 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).

Alternatives

Alternatives for antigen "Chromosome 21 Open Reading Frame 7 (C21orf7)", type "Antibodies"
Hosts Rabbit (3)
Reactivities Human (2)
Applications Western Blotting (WB) (3), Immunohistochemistry (IHC) (2), ELISA (1)
Epitopes C-Term (1), C-Term,AA 215-241 (1)