Alkaline Phosphatase, Placental-Like 2 (ALPPL2) antibody

Antigen: Alkaline Phosphatase, Placental-Like 2 (ALPPL2)

Synonyms: ALPG, GCAP, ALPPL, EAP, Akp5, C77216, D1Ertd816e, ALPP, ALPPL2

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN310377

Additional Information

Alternative name: Alkaline phosphatase / ALPPL

Gene ID: ALPPL2

UniProt: P10696

Immunogen: The immunogen for anti-ALPPL2 antibody: synthetic peptide directed towards the N terminal of human ALPPL2

Sequence: MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALG AAKKLQPAQT

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-ALPPL2 antibody concentration is 1 mg/ml.

Description: There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The exact physiological function of the alkaline phosphatases is not known. ALPPL2 is a membrane bound glycosylated enzyme, localized to testis, thymus and certain germ cell tumors, that is closely related to both the placental and intestinal forms of alkaline phosphatase.There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The first three are located together on chromosome 2 while the tissue non-specific form is located on chromosome 1. The exact physiological function of the alkaline phosphatases is not known. The product of this gene is a membrane bound glycosylated enzyme, localized to testis, thymus and certain germ cell tumors, that is closely related to both the placental and intestinal forms of alkaline phosphatase.

Characteristics: Antigen Size: 532 amino acids

Molecular Weight: 59kDa

Application Details

Application Notes: WB Suggested Anti-ALPPL2 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ALPPL2 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate

Publications

Product: Nakano, Shimanuki, Matsushita et al.: "Involvement of intestinal alkaline phosphatase in serum apolipoprotein B-48 level and its association with ABO and secretor blood group types." in: Biochemical and biophysical research communications, Vol. 341, Issue 1, pp. 33-8, 2006 (PubMed).