Interferon Regulatory Factor 6 (IRF6) antibody

Antigen: Interferon Regulatory Factor 6 (IRF6)

Synonyms: LPS, PIT, PPS, VWS, OFC6, mirf6, AI876454, E230028I05Rik, MGC63500, zgc:63500, IRF6, xIRF-6, MGC81304, lps, pit, pps, vws, ofc6, MGC143192, DKFZp469E012

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish, Chicken, Pig (Porcine), Xenopus laevis

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN310490

Additional Information

Alternative name: IRF6

Gene ID: IRF6

UniProt: O14896

Immunogen: The immunogen for anti-IRF6 antibody: synthetic peptide directed towards the C terminal of human IRF6

Sequence: FLSDLIAHQKGQIEKQPPFEIYLCFGEEWPDGKPLERKLI LVQVIPVVAR

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-IRF6 antibody concentration is 1 mg/ml.

Description: IRF6 is a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. Mutations in its gene can cause van der Woude syndrome and popliteal pterygium syndrome. This protein is involved in palate formation.The protein encoded by this gene shares strong similarity with Saccharomyces cerevisiae Cdc23, a protein essential for cell cycle progression through the G2/M transition. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eucaryotic cells. APC catalyzes the formation of cyclin B-ubiquitin conjugate that is responsible for the ubiquitin-mediated proteolysis of B-type cyclins. This protein and 3 other members of the APC complex contain the TPR (tetratricopeptide repeat), a protein domain important for protein-protein interaction.

Characteristics: Antigen Size: 591 amino acids

Molecular Weight: 65kDa

Application Details

Application Notes: WB Suggested Anti-IRF6 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors, Innate Immunity, Cytokines

Restrictions: For Research Use only

Images

WB Suggested Anti-IRF6 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate

Publications

Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).