Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Coiled-Coil Domain Containing 112 (CCDC112) antibody

Antigen

Coiled-Coil Domain Containing 112 (CCDC112)

Synonyms MBC1, MGC39633, AW108467, 8430438M01Rik, CCDC112, RGD1561942
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN310643
Quantity 0.1 mg
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name CCDC112
Gene ID MGC39633
UniProt Q6A334
Immunogen The immunogen for anti-MGC39633 antibody: synthetic peptide directed towards the N terminal of human MGC39633
Sequence VRTAEKFKNQVINMEKDKHSHFYNQKSDFRIEHSMLEELE NKLIHSRKTE
Cross-Reactivity Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-MGC39633 antibody concentration is 1 mg/ml.
Description The function remains unknown.
Characteristics Antigen Size: 529 amino acids
Molecular Weight 62kDa

Application Details

Application Notes WB Suggested Anti-MGC39633 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Brandenberger, Wei, Zhang et al.: "Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation." in: Nature biotechnology, Vol. 22, Issue 6, pp. 707-16, 2004 (PubMed).

Alternatives

Alternatives for antigen "Coiled-Coil Domain Containing 112 (CCDC112)", type "Antibodies"
Hosts Rabbit (19)
Reactivities Human (19), Dog (Canine) (17), Mouse (Murine) (17)
Applications Immunofluorescence (IF) (14), Western Blotting (WB) (4), ELISA (3), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (2), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes N-Term (1), N-Term,AA 1-30 (1)