Signal Sequence Receptor, beta (Translocon-Associated Protein Beta) (SSR2) antibody

Antigen: Signal Sequence Receptor, beta (Translocon-Associated Protein Beta) (SSR2)

Synonyms: TLAP, HSD25, TRAPB, TRAP-BETA, DKFZp686F19123, AI315033, AU020133, TRAPbeta, 1500032E05Rik, SSR2, MUA22.2, MUA22_2

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish, Chicken, Xenopus laevis

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN310681

Additional Information

Alternative name: SSR2 / TRAPB

Gene ID: SSR2

UniProt: P43308

Immunogen: The immunogen for anti-SSR2 antibody: synthetic peptide directed towards the N terminal of human SSR2

Sequence: SFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQY NIYNVGSSAA

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-SSR2 antibody concentration is 1 mg/ml.

Description: The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34-kD glycoprotein (alpha-SSR or SSR1) and a 22-kD glycoprotein (beta-SSR or SSR2).The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34-kD glycoprotein (alpha-SSR or SSR1) and a 22-kD glycoprotein (beta-SSR or SSR2). The human beta-signal sequence receptor gene (SSR2) maps to chromosome bands 1q21-q23.

Characteristics: Antigen Size: 183 amino acids

Molecular Weight: 20kDa

Application Details

Application Notes: WB Suggested Anti-SSR2 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-SSR2 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate

anti-Signal Sequence Receptor, beta (Translocon-Associated Protein Beta) (SSR2) antibody (Image 2)

Publications

Product: Suzuki, Yoshitomo-Nakagawa, Maruyama et al.: "Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library." in: Gene, Vol. 200, Issue 1-2, pp. 149-56, 1997 (PubMed).