Non-SMC Condensin I Complex, Subunit H (NCAPH) antibody

Antigen: Non-SMC Condensin I Complex, Subunit H (NCAPH)

Synonyms: BRRN1, CAP-H, HCAP-H, NCAPH, MGC127159, MGC158618, si:dkeyp-86b9.4

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN310794

Additional Information

Alternative name: NCAPH

Gene ID: NCAPH

UniProt: Q15003

Immunogen: The immunogen for anti-NCAPH antibody: synthetic peptide directed towards the C terminal of human NCAPH

Sequence: TKDLQRSLPPVMAQNLSIPLAFACLLHLANEKNLKLEGTE DLSDVLVRQG

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-NCAPH antibody concentration is 1 mg/ml.

Description: NCAPH is a member of the barr family and a regulatory subunit of the condensin complex. This complex is required for the conversion of interphase chromatin into condensed chromosomes. The protein is associated with mitotic chromosomes, except during the early phase of chromosome condensation. During interphase, the protein has a distinct punctate nucleolar localization.This gene encodes a member of the barr gene family and a regulatory subunit of the condensin complex. This complex is required for the conversion of interphase chromatin into condensed chromosomes. The protein encoded by this gene is associated with mitotic chromosomes, except during the early phase of chromosome condensation. During interphase, the protein has a distinct punctate nucleolar localization.

Characteristics: Antigen Size: 741 amino acids

Molecular Weight: 82kDa

Application Details

Application Notes: WB Suggested Anti-NCAPH Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-NCAPH Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Publications

Beausoleil, Villén, Gerber et al.: "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." in: Nature biotechnology, Vol. 24, Issue 10, pp. 1285-92, 2006 (PubMed).