Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

FIC Domain Containing (FICD) antibody

Antigen

FIC Domain Containing (FICD)
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Fruit Fly (Drosophila melanogaster)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
2 references available
Catalog no. ABIN310856
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-FIC Domain Containing (FICD) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name HIP13 / FICD
Gene ID FICD
UniProt Q9BVA6
Immunogen The immunogen for anti-FICD antibody: synthetic peptide directed towards the C terminal of human FICD
Sequence FAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPIT IRKEQRSDYY
Cross-Reactivity Cow (Bovine), Dog (Canine), Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-FICD antibody concentration is 1 mg/ml.
Description The function remains known.
Characteristics Antigen Size: 458 amino acids
Molecular Weight 52kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-FICD Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Clark, Edwards, Peterson et al.: "Fugu ESTs: new resources for transcription analysis and genome annotation." in: Genome research, Vol. 13, Issue 12, pp. 2747-53, 2003 (PubMed).

Product Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "FIC Domain Containing (FICD)", type "Antibodies"
Hosts Rabbit (23)
Reactivities Human (21), Dog (Canine) (19), Mouse (Murine) (19), Rat (Rattus) (19), Horse (Equine) (18), Pig (Porcine) (18), Sheep (Ovine) (18), Cow (Bovine) (1)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (8), ELISA (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (IHC) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes C-Term (2)