Did you know that you can buy products from over 140 different suppliers from us?

WSC Domain Containing 2 (WSCD2) (C-Term) antibody

Details for Product No. ABIN310879
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Gm450, 4933413A10Rik, C530024P05Rik, si:ch211-240b21.1
Epitope
C-Term
(9), (7), (2)
Reactivity
Dog (Canine), Zebrafish (Danio rerio), Human
(11)
Host
Rabbit
(12)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(12), (7), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN310879
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human WSCD2
Sequence GNFKRSGLRKLEYDPYTADMQKTISAYIKMVDAALKGRNL TGVPDDYYPR
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Pig : 100 %, Chicken : 90 %, Rabbit : 90 %, Zebrafish : 70 %
Characteristics This is a rabbit polyclonal antibody against WSCD2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name WSCD2
Background The function remains known.
Molecular Weight 64 kDa
Gene ID 9671
NCBI Accession NM_014653, NP_055468
UniProt Q2TBF2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 565 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-WSC Domain Containing 2 (WSCD2) (C-Term) antibody WB Suggested Anti-WSCD2 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate
Background publications Nagase, Ishikawa, Suyama et al.: "Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." in: DNA research : an international journal for rapid publication of reports on genes and genomes, Vol. 5, Issue 5, pp. 277-86, 1999 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310879
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top