MAFK antibody

Antigen: MAFK

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken, Xenopus laevis, Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN310919

Additional Information

Gene ID: MAFK

UniProt: O60675

Immunogen: The immunogen for anti-MAFK antibody: synthetic peptide directed towards the N terminal of human MAFK

Sequence: KEAGENAPVLSDDELVSMSVRELNQHLRGLTKEEVTRLKQ RRRTLKNRGY

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-MAFK antibody concentration is 1 mg/ml.

Description: The developmentally regulated expression of the globin genes depends on upstream regulatory elements termed locus control regions (LCRs). LCRs are associated with powerful enhancer activity that is mediated by the transcription factor NFE2. NFE2 recognition sites are also present in the gene promoters of 2 heme biosynthetic enzymes, PBGD and FECH. NFE2 DNA-binding activity consists of a heterodimer containing an 18-kD Maf protein (MafF, MafG, or MafK) and p45. Both subunits are members of the activator protein-1 superfamily of bZIP proteins. Maf homodimers suppress transcription at NFE2 sites.The developmentally regulated expression of the globin genes depends on upstream regulatory elements termed locus control regions (LCRs). LCRs are associated with powerful enhancer activity that is mediated by the transcription factor NFE2 (nuclear factor erythroid-2). NFE2 recognition sites are also present in the gene promoters of 2 heme biosynthetic enzymes, porphobilinogen deaminase (PBGD, MIM 176000) and ferrochelatase (FECH, MIM 177000). NFE2 DNA-binding activity consists of a heterodimer containing an 18-kD Maf protein (MafF, MafG (MIM 602020), or MafK) and p45 (MIM 601490). Both subunits are members of the activator protein-1 superfamily of basic leucine zipper (bZIP) proteins (see MIM 165160). Maf homodimers suppress transcription at NFE2 sites.[supplied by OMIM].

Characteristics: Antigen Size: 156 amino acids

Molecular Weight: 17kDa

Application Details

Application Notes: WB Suggested Anti-MAFK Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-MAFK Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate

Publications

Product: Hillier, Fulton, Fulton et al.: "The DNA sequence of human chromosome 7." in: Nature, Vol. 424, Issue 6945, pp. 157-64, 2003 (PubMed).