ZNF36 (ZKSCAN1) antibody

Antigen: ZNF36 (ZKSCAN1)

Synonyms: KOX18, ZNF36, PHZ-37, ZNF139, MGC138429, 9130423L19Rik

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN310922

Additional Information

Alternative name: ZNF36

Gene ID: ZKSCAN1

UniProt: P17029

Immunogen: The immunogen for anti-ZKSCAN1 antibody: synthetic peptide directed towards the N terminal of human ZKSCAN1

Sequence: NTKEQILELLVLEQFLSILPKELQVWLQEYRPDSGEEAVT LLEDLELDLS

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-ZKSCAN1 antibody concentration is 1 mg/ml.

Description: ZKSCAN1 may be involved in transcriptional regulation.

Characteristics: Antigen Size: 563 amino acids

Molecular Weight: 63kDa

Application Details

Application Notes: WB Suggested Anti-ZKSCAN1 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ZKSCAN1 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate

Publications

Product: Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).