Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310986

Prolyl 4-Hydroxylase, beta Polypeptide (P4HB) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CG6988, Dmel\\CG6988, Dpdi, EP(3)1022, PDI, dpdi, pdi, XPDIp, DSI, GIT, PHDB, PDIA1, PO4DB, PO4HB, PROHB, ERBA2L, P4Hbeta, Thbp, ERp59, Pdia1, PDIR, p55
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN310986
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-P4HB antibody: synthetic peptide directed towards the N terminal of human P4HB
Sequence TIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTL PDGAAAESLV
Predicted Reactivity Bovine : 100%, Human : 100%, Mouse : 100%, Dog : 85%, African clawed frog : 78%
Characteristics This is a rabbit polyclonal antibody against P4HB. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name P4HB
Background P4HB is the beta subunit of prolyl 4-hydroxylase, a highly abundant multifunctional enzyme that belongs to the protein disulfide isomerase family. When present as a tetramer consisting of two alpha and two beta subunits, this enzyme is involved in hydroxylation of prolyl residues in preprocollagen. This enzyme is also a disulfide isomerase containing two thioredoxin domains that catalyze the formation, breakage and rearrangement of disulfide bonds. Other known functions include its ability to act as a chaperone that inhibits aggregation of misfolded proteins in a concentration-dependent manner, its ability to bind thyroid hormone, its role in both the influx and efflux of S-nitrosothiol-bound nitric oxide, and its function as a subunit of the microsomal triglyceride transfer protein complex.This gene encodes the beta subunit of prolyl 4-hydroxylase, a highly abundant multifunctional enzyme that belongs to the protein disulfide isomerase family. When present as a tetramer consisting of two alpha and two beta subunits, this enzyme is involved in hydroxylation of prolyl residues in preprocollagen. This enzyme is also a disulfide isomerase containing two thioredoxin domains that catalyze the formation, breakage and rearrangement of disulfide bonds. Other known functions include its ability to act as a chaperone that inhibits aggregation of misfolded proteins in a concentration-dependent manner, its ability to bind thyroid hormone, its role in both the influx and efflux of S-nitrosothiol-bound nitric oxide, and its function as a subunit of the microsomal triglyceride transfer protein complex.
Molecular Weight 55kDa
Gene ID 5034
NCBI Accession NP_000909, NM_000918
UniProt P07237
Research Area Cancer, Extracellular Matrix
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-P4HB antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Prolyl 4-Hydroxylase, beta Polypeptide (P4HB)", type "Antibodies"
Hosts (57), (22)
Reactivities (62), (43), (38), (17), (15), (13), (8), (7), (7), (6), (5), (4), (3), (2), (1), (1)
Applications (62), (25), (22), (21), (20), (15), (14), (11), (9), (6), (3), (2), (1), (1), (1), (1)
Conjugates (4), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Epitopes (6), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Beacon