Prolyl 4-Hydroxylase, beta Polypeptide (P4HB) antibody

Antigen: Prolyl 4-Hydroxylase, beta Polypeptide (P4HB)

Synonyms: DSI, GIT, PDI, PHDB, PDIA1, PO4DB, PO4HB, PROHB, ERBA2L, P4Hbeta, Thbp, ERp59, Pdia1, PDIR, LOC100328595, p55, P4HB, DKFZp469E2031

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Rabbit, Chicken, Xenopus laevis

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN310987

Additional Information

Alternative name: PDI

Gene ID: P4HB

UniProt: P07237

Immunogen: The immunogen for anti-P4HB antibody: synthetic peptide directed towards the C terminal of human P4HB

Sequence: DRTVIDYNGERTLDGFKKFLESGGQDGAGDDDDLEDLEEA EEPDMEEDDD

Cross-Reactivity: Cow (Bovine), Chicken, Human, Mouse (Murine), Rabbit, Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-P4HB antibody concentration is 1 mg/ml.

Description: P4HB is the beta subunit of prolyl 4-hydroxylase, a highly abundant multifunctional enzyme that belongs to the protein disulfide isomerase family. When present as a tetramer consisting of two alpha and two beta subunits, this enzyme is involved in hydroxylation of prolyl residues in preprocollagen. This enzyme is also a disulfide isomerase containing two thioredoxin domains that catalyze the formation, breakage and rearrangement of disulfide bonds. Other known functions include its ability to act as a chaperone that inhibits aggregation of misfolded proteins in a concentration-dependent manner, its ability to bind thyroid hormone, its role in both the influx and efflux of S-nitrosothiol-bound nitric oxide, and its function as a subunit of the microsomal triglyceride transfer protein complex.This gene encodes the beta subunit of prolyl 4-hydroxylase, a highly abundant multifunctional enzyme that belongs to the protein disulfide isomerase family. When present as a tetramer consisting of two alpha and two beta subunits, this enzyme is involved in hydroxylation of prolyl residues in preprocollagen. This enzyme is also a disulfide isomerase containing two thioredoxin domains that catalyze the formation, breakage and rearrangement of disulfide bonds. Other known functions include its ability to act as a chaperone that inhibits aggregation of misfolded proteins in a concentration-dependent manner, its ability to bind thyroid hormone, its role in both the influx and efflux of S-nitrosothiol-bound nitric oxide, and its function as a subunit of the microsomal triglyceride transfer protein complex. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 508 amino acids

Molecular Weight: 55kDa

Application Details

Application Notes: WB Suggested Anti-P4HB Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Cancer, Organelles

Restrictions: For Research Use only

Images

WB Suggested Anti-P4HB Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Publications

Product: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).