Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Insulin-Like Growth Factor Binding Protein 7 (IGFBP7) antibody

Antigen

Insulin-Like Growth Factor Binding Protein 7 (IGFBP7)

Synonyms Fstl2, Mac25, MGC85888, zgc:85888, PSF, FSTL2, MAC25, IGFBP-7, IGFBP-7v, IGFBPRP1
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Rat (Rattus), Mouse (Murine), Dog (Canine), Pig (Porcine)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN310993
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name IGFBP7
Gene ID IGFBP7
UniProt Q16270
Immunogen The immunogen for anti-IGFBP7 antibody: synthetic peptide directed towards the C terminal of human IGFBP7
Sequence RGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASAS AKITVVDALH
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-IGFBP7 antibody concentration is 1 mg/ml.
Description IGFBP7 contains 1 Ig-like C2-type (immunoglobulin-like) domain, 1 IGFBP N-terminal domain and 1 Kazal-like domain. It binds IGF-I and IGF-II with a relatively low affinity. IGFBP7 stimulates prostacyclin (PGI2) production.
Characteristics Antigen Size: 282 amino acids
Molecular Weight 29kDa

Application Details

Application Notes WB Suggested Anti-IGFBP7 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Muscle.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Cancer
Restrictions For Research Use only

Publications

Product Wajapeyee, Serra, Zhu et al.: "Oncogenic BRAF induces senescence and apoptosis through pathways mediated by the secreted protein IGFBP7." in: Cell, Vol. 132, Issue 3, pp. 363-74, 2008 (PubMed).

Alternatives

Alternatives for antigen "Insulin-Like Growth Factor Binding Protein 7 (IGFBP7)", type "Antibodies"
Hosts Rabbit (33), Goat (6), Rat (1)
Reactivities Human (35), Mouse (Murine) (22), Rat (Rattus) (20), Cow (Bovine) (18), Dog (Canine) (18), Sheep (Ovine) (18)
Applications ELISA (23), Western Blotting (WB) (21), Immunofluorescence (IF) (15), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1), Immunoprecipitation (IP) (1)
Conjugates Biotin (6), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes AA 145-159 (2), Internal Region (2), C-Term (1)