Aldolase C, Fructose-Bisphosphate (ALDOC) (N-Term) antibody

Details for Product No. ABIN311015
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms ALDC, AI847350, AU040929, Aldo3, Scrg2, ALDCAA, F16dip7, RATALDCAA, MGC69434, ALDOC
Epitope
N-Term
(11), (5), (2), (2), (2), (2), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human
(54), (34), (29), (15), (14), (14), (12), (1), (1)
Host
Rabbit
(45), (10), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(36), (21), (13), (13), (10), (6), (4), (4), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN311015
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ALDOC
Sequence MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSM AKRLSQIGVE
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, African clawed frog : 90 %
Characteristics This is a rabbit polyclonal antibody against ALDOC. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ALDOC
Background ALDOC gene is a member of the class I fructose-biphosphate aldolase gene family. ALDOC is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively.This gene encodes a member of the class I fructose-biphosphate aldolase gene family. Expressed specifically in the hippocampus and Purkinje cells of the brain, the encoded protein is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively.
Molecular Weight 39 kDa
Gene ID 230
NCBI Accession NM_005165, NP_005156
UniProt P09972
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 364 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Aldolase C, Fructose-Bisphosphate (ALDOC) (N-Term) antibody WB Suggested Anti-ALDOC Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Background publications Kim, Sprung, Chen et al.: "Substrate and functional diversity of lysine acetylation revealed by a proteomics survey." in: Molecular cell, Vol. 23, Issue 4, pp. 607-18, 2006 (PubMed).

Hosts (45), (10), (2)
Reactivities (54), (34), (29), (15), (14), (14), (12), (1), (1)
Applications (36), (21), (13), (13), (10), (6), (4), (4), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (11), (5), (2), (2), (2), (2), (1)
back to top