Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Aldolase C, Fructose-Bisphosphate (ALDOC) antibody

Antigen

Aldolase C, Fructose-Bisphosphate (ALDOC)

Synonyms ALDC, aldoc, MGC52977, MGC69434, ALDOC
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish, Rabbit

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN311015
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name Aldolase C / ALDOC
Gene ID ALDOC
UniProt P09972
Immunogen The immunogen for anti-ALDOC antibody: synthetic peptide directed towards the N terminal of human ALDOC
Sequence MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSM AKRLSQIGVE
Cross-Reactivity Cow (Bovine), Human, Mouse (Murine), Rabbit, Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-ALDOC antibody concentration is 1 mg/ml.
Description ALDOC gene is a member of the class I fructose-biphosphate aldolase gene family. ALDOC is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively.This gene encodes a member of the class I fructose-biphosphate aldolase gene family. Expressed specifically in the hippocampus and Purkinje cells of the brain, the encoded protein is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively.
Characteristics Antigen Size: 364 amino acids
Molecular Weight 39kDa

Application Details

Application Notes WB Suggested Anti-ALDOC Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Enzymes
Restrictions For Research Use only

Publications

Product Kim, Sprung, Chen et al.: "Substrate and functional diversity of lysine acetylation revealed by a proteomics survey." in: Molecular cell, Vol. 23, Issue 4, pp. 607-18, 2006 (PubMed).

Alternatives

Alternatives for antigen "Aldolase C, Fructose-Bisphosphate (ALDOC)", type "Antibodies"
Hosts Rabbit (20), Sheep (2)
Reactivities Human (21), Mouse (Murine) (8), Rat (Rattus) (6), Chicken (2), Cow (Bovine) (2), Cat (Feline) (1), Dog (Canine) (1), Zebrafish (1)
Applications Western Blotting (WB) (19), ELISA (17), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunofluorescence (IF) (3), Immunohistochemistry (IHC) (3), Radioimmunoassay (RIA) (2), Immunohistochemistry (Fixed) (IHC (fx)) (1), Immunohistochemistry (Frozen Sections) (IHC (fro)) (1), Immunoprecipitation (IP) (1)
Epitopes C-Term (5), N-Term (3), Internal Region (1), N-Term,AA 79-108 (1)