Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Chromosome 19 Open Reading Frame 47 (C19orf47) antibody

Antigen

Chromosome 19 Open Reading Frame 47 (C19orf47)
Synonyms FLJ36888, DKFZp686P05129, MGC81894, MGC79696
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Human, Mouse (Murine)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN311037
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Chromosome 19 Open Reading Frame 47 (C19orf47) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name C19orf47
Gene ID C19orf47
UniProt Q8N9M1-2
Immunogen The immunogen for anti-C19orf47 antibody: synthetic peptide directed towards the C terminal of human C19orf47
Sequence DSQVTSTKSKSSAEVKVTIKRTLVGPRGSSSSEGLGAQMD HAGTVSVFKR
Cross-Reactivity Human, Mouse (Murine)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-C19orf47 antibody concentration is 1 mg/ml.
Description The function remains unknown.
Characteristics Antigen Size: 355 amino acids
Molecular Weight 38kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-C19orf47 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "Chromosome 19 Open Reading Frame 47 (C19orf47)", type "Antibodies"
Hosts Rabbit (23)
Reactivities Human (21), Cow (Bovine) (19), Mouse (Murine) (19), Rat (Rattus) (19), Xenopus laevis (1), Zebrafish (1)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (8), ELISA (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes C-Term (1), Internal Region (1)