Transketolase-Like 2 (TKTL2) antibody

Antigen: Transketolase-Like 2 (TKTL2)

Synonyms: FLJ32975, DKFZp434L1717, 4933401I19Rik, RGD1304767, cb860, fb38f03, fj52f12, id:ibd3270, wu:fb38f03, wu:fj52f12, wu:cegs2794, MGC69114, MGC76292, TKTL2, MGC133952

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN311111

Additional Information

Alternative name: TKTL2

Gene ID: TKTL2

UniProt: Q9H0I9

Immunogen: The immunogen for anti-TKTL2 antibody: synthetic peptide directed towards the C terminal of human TKTL2

Sequence: SSAKATGGRVITVEDHYREGGIGEAVCAAVSREPDILVHQ LAVSGVPQRG

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-TKTL2 antibody concentration is 1 mg/ml.

Description: The function remains unknown.

Characteristics: Antigen Size: 626 amino acids

Molecular Weight: 68kDa

Application Details

Application Notes: WB Suggested Anti-TKTL2 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling, Metabolism

Restrictions: For Research Use only

Images

WB Suggested Anti-TKTL2 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate

Publications

Product: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).