Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Glycosyltransferase-Like Domain Containing 2 (GTDC2) antibody

Antigen

Glycosyltransferase-Like Domain Containing 2 (GTDC2)
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN311114
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Glycosyltransferase-Like Domain Containing 2 (GTDC2) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name AGO61 / C3orf39
Gene ID C3orf39
UniProt Q8NAT1
Immunogen The immunogen for anti-C3orf39 antibody: synthetic peptide directed towards the middle region of human C3orf39
Sequence TTLFLPRGATVVELFPYAVNPDHYTPYKTLAMLPGMDLQY VAWRNMMPEN
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-C3orf39 antibody concentration is 1 mg/ml.
Description The function remains unknown.
Characteristics Antigen Size: 580 amino acids
Molecular Weight 66kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-C3orf39 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Gerhard, Wagner, Feingold et al.: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, 2004 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "Glycosyltransferase-Like Domain Containing 2 (GTDC2)", type "Antibodies"
Hosts Rabbit (24)
Reactivities Human (23), Mouse (Murine) (21), Rat (Rattus) (21), Cow (Bovine) (3), Dog (Canine) (3), Chicken (1)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (9), ELISA (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes Internal Region (1), N-Term (1)