Transglutaminase 7 (TGM7) antibody

Antigen: Transglutaminase 7 (TGM7)

Synonyms: TGMZ, TGM7, TGz

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine)

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN311118

Additional Information

Alternative name: Transglutaminase-7 (TGM7)

Gene ID: TGM7

UniProt: Q96PF1

Immunogen: The immunogen for anti-TGM7 antibody: synthetic peptide directed towards the C terminal of human TGM7

Sequence: TQKPFWRHTVRMNLDFGKETQWPLLLPYSNYRNKLTDEKL IRVSGIAEVE

Cross-Reactivity: Human, Mouse (Murine)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TGM7 antibody concentration is 1 mg/ml.

Description: Transglutaminases (TGM, EC 2.3.2.13) are a family of structurally and functionally related enzymes that stabilize protein assemblies through the formation of gamma-glutamyl-epsilon¡¡lysine crosslinks. Transglutaminases (TGM, EC 2.3.2.13) are a family of structurally and functionally related enzymes that stabilize protein assemblies through the formation of gamma-glutamyl-epsilon lysine crosslinks. For additional background information on transglutaminases, see TGM1 (MIM 190195).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2110 AF363393.1 1-2110 2111-2312 BX112796.1 167-368

Characteristics: Antigen Size: 710 amino acids

Molecular Weight: 80kDa

Application Details

Application Notes: WB Suggested Anti-TGM7 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TGM7 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysate

Publications

Product: Grenard, Bates, Aeschlimann: "Evolution of transglutaminase genes: identification of a transglutaminase gene cluster on human chromosome 15q15. Structure of the gene encoding transglutaminase X and a novel gene family member, transglutaminase Z." in: The Journal of biological chemistry, Vol. 276, Issue 35, pp. 33066-78, 2001 (PubMed).