Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311131

Transmembrane and Tetratricopeptide Repeat Containing 2 (TMTC2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms IBDBP1, 8430438D04Rik, D330034A10Rik, RGD1309848, si:ch211-161n3.1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311131
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TMTC2 antibody: synthetic peptide directed towards the N terminal of human TMTC2
Sequence SNSDNPAADSDSLLTRTLTFFYLPTKNLWLLLCPDTLSFD WSMDAVPLLK
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Zebrafish : 100%
Characteristics This is a rabbit polyclonal antibody against TMTC2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TMTC2
Background TMTC2 is a multi-pass membrane protein, which contains 10 TPR repeats.It belongs to the TMTC family. The exact function of TMTC2 remains unknown.
Molecular Weight 94kDa
Gene ID 160335
NCBI Accession NP_689801, NM_152588
UniProt Q8N394
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TMTC2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).

Alternatives for antigen "Transmembrane and Tetratricopeptide Repeat Containing 2 (TMTC2)", type "Antibodies"
Hosts (3)
Reactivities (2), (1), (1), (1), (1), (1), (1), (1)
Applications (3), (1)
Epitopes (1), (1)
Beacon