Did you know that you can buy products from over 140 different suppliers from us?

Transmembrane and Tetratricopeptide Repeat Containing 2 (TMTC2) (N-Term) antibody

Details for Product No. ABIN311131
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms IBDBP1, 8430438D04Rik, D330034A10Rik, RGD1309848, si:ch211-161n3.1
Epitope
N-Term
(1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Xenopus laevis, Human
(2)
Host
Rabbit
(3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(3)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN311131
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TMTC2
Sequence SNSDNPAADSDSLLTRTLTFFYLPTKNLWLLLCPDTLSFD WSMDAVPLLK
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Zebrafish : 100 %
Characteristics This is a rabbit polyclonal antibody against TMTC2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TMTC2
Background TMTC2 is a multi-pass membrane protein, which contains 10 TPR repeats.It belongs to the TMTC family. The exact function of TMTC2 remains unknown.
Molecular Weight 94 kDa
Gene ID 160335
NCBI Accession NM_152588, NP_689801
UniProt Q8N394
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 836 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Transmembrane and Tetratricopeptide Repeat Containing 2 (TMTC2) (N-Term) antibody WB Suggested Anti-TMTC2 Antibody Titration: 0.2-1 ug/ml
Positive Control: MCF7 cell lysate
Background publications Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).

Hosts (3)
Reactivities (2)
Applications (3)
Epitopes (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN311131
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top