Transmembrane and Tetratricopeptide Repeat Containing 2 (TMTC2) antibody

Antigen: Transmembrane and Tetratricopeptide Repeat Containing 2 (TMTC2)

Synonyms: DKFZp762A217

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus), Zebrafish, Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN311131

Additional Information

Alternative name: TMTC2

Gene ID: TMTC2

UniProt: Q8N394

Immunogen: The immunogen for anti-TMTC2 antibody: synthetic peptide directed towards the N terminal of human TMTC2

Sequence: SNSDNPAADSDSLLTRTLTFFYLPTKNLWLLLCPDTLSFD WSMDAVPLLK

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TMTC2 antibody concentration is 1 mg/ml.

Description: TMTC2 is a multi-pass membrane protein, which contains 10 TPR repeats.It belongs to the TMTC family. The exact function of TMTC2 remains unknown.

Characteristics: Antigen Size: 836 amino acids

Molecular Weight: 94kDa

Application Details

Application Notes: WB Suggested Anti-TMTC2 Antibody Titration: 0.2-1 ug/ml
Positive Control: MCF7 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TMTC2 Antibody Titration: 0.2-1 ug/ml
Positive Control: MCF7 cell lysate

Publications

Product: Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).