Transglutaminase 5 (TGM5) antibody

Antigen: Transglutaminase 5 (TGM5)

Synonyms: TGX, TGM6, TGMX, MGC141907, TGx, MGC143848, MGC143849, 2310007C07Rik, TGM5, MGC151861

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Dog (Canine), Cow (Bovine)

Application: Western Blotting (WB)

Catalog no.: ABIN311154

Additional Information

Alternative name: Transglutaminase-5 (TGM5)

Gene ID: TGM5

UniProt: O43548

Immunogen: The immunogen for anti-TGM5 antibody: synthetic peptide directed towards the C terminal of human TGM5

Sequence: VLKPQHQASIILETVPFKSGQRQIQANMRSNKFKDIKGYR NVYVDFAL

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TGM5 antibody concentration is 1 mg/ml.

Description: TGM5 belongs to the transglutaminase superfamily, transglutaminase family. It catalyzes the cross-linking of proteins and the conjugation of polyamines to proteins. It contributes to the formation of the cornified cell envelope of keratinocytes. Defects in TGM5 are a cause of peeling skin syndrome acral type (APSS).

Characteristics: Antigen Size: 720 amino acids

Molecular Weight: 81kDa

Application Details

Application Notes: WB Suggested Anti-TGM5 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TGM5 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate

Publications

Product: Cassidy, van Steensel, Steijlen et al.: "A homozygous missense mutation in TGM5 abolishes epidermal transglutaminase 5 activity and causes acral peeling skin syndrome." in: American journal of human genetics, Vol. 77, Issue 6, pp. 909-17, 2005 (PubMed).