Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Sulfatase 2 (SULF2) antibody

Antigen

Sulfatase 2 (SULF2)

Synonyms HSULF-2, FLJ44488, FLJ90554, KIAA1247, MGC126411, DKFZp313E091, AU020235, mKIAA1247, 2010004N24Rik, Sulf1, MGC55612, zgc:55612, xtsulf2, SULF2, fb48e04, wu:fb48e04
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken, Xenopus laevis

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN311170
Quantity 0.1 mg
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name SULF2
Gene ID SULF2
UniProt Q8IWU5
Immunogen The immunogen for anti-SULF2 antibody: synthetic peptide directed towards the C terminal of human SULF2
Sequence DVLNQLHVQLMELRSCKGYKQCNPRTRNMDLGLKDGGSYE QYRQFQRRKW
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-SULF2 antibody concentration is 1 mg/ml.
Description Heparan sulfate proteoglycans (HSPGs) act as coreceptors for numerous heparin-binding growth factors and cytokines and are involved in cell signaling. Heparan sulfate 6-O-endosulfatases, such as SULF2, selectively remove 6-O-sulfate groups from heparan sulfate. This activity modulates the effects of heparan sulfate by altering binding sites for signaling molecules.Heparan sulfate proteoglycans (HSPGs) act as coreceptors for numerous heparin-binding growth factors and cytokines and are involved in cell signaling. Heparan sulfate 6-O-endosulfatases, such as SULF2, selectively remove 6-O-sulfate groups from heparan sulfate. This activity modulates the effects of heparan sulfate by altering binding sites for signaling molecules (Dai et al., 2005 [PubMed 16192265]).[supplied by OMIM].
Characteristics Antigen Size: 870 amino acids
Molecular Weight 98kDa

Application Details

Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Uchimura, Morimoto-Tomita, Bistrup et al.: "HSulf-2, an extracellular endoglucosamine-6-sulfatase, selectively mobilizes heparin-bound growth factors and chemokines: effects on VEGF, FGF-1, and SDF-1." in: BMC biochemistry, Vol. 7, pp. 2, 2006 (PubMed).

Alternatives

Alternatives for antigen "Sulfatase 2 (SULF2)", type "Antibodies"
Hosts Rabbit (26), Goat (3)
Reactivities Human (28), Mouse (Murine) (20), Chicken (19), Cow (Bovine) (19), Dog (Canine) (19), Pig (Porcine) (19), Rat (Rattus) (19)
Applications Immunofluorescence (IF) (16), Western Blotting (WB) (13), ELISA (8), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunohistochemistry (IHC) (2), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Flour 488 (1), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes C-Term (2), Internal Region (1)