Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Abhydrolase Domain Containing 13 (ABHD13) antibody

Antigen

Abhydrolase Domain Containing 13 (ABHD13)

Synonyms BEM46L1, C13orf6, FLJ14906, MGC27058, bA153I24.2, RP11-153I24.2, AI463703, AI788994, 1110065L07Rik, RGD1308317, MGC83139, MGC123286, zgc:123286
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Chicken

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN311251
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name ABHD13
Gene ID ABHD13
UniProt Q7L211
Immunogen The immunogen for anti-ABHD13 antibody: synthetic peptide directed towards the N terminal of human ABHD13
Sequence SRLYVPMPTGIPHENIFIRTKDGIRLNLILIRYTGDNSPY SPTIIYFHGN
Cross-Reactivity Cow (Bovine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-ABHD13 antibody concentration is 1 mg/ml.
Description ABHD13 is a single-pass type II membrane protein. It belongs to the serine esterase family. The exact function of ABHD13 remains unknown.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
Characteristics Antigen Size: 337 amino acids
Molecular Weight 38kDa

Application Details

Application Notes WB Suggested Anti-ABHD13 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Placenta.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Dunham, Matthews, Burton et al.: "The DNA sequence and analysis of human chromosome 13." in: Nature, Vol. 428, Issue 6982, pp. 522-8, 2004 (PubMed).

Alternatives

Alternatives for antigen "Abhydrolase Domain Containing 13 (ABHD13)", type "Antibodies"
Hosts Rabbit (25)
Reactivities Human (23), Cow (Bovine) (20), Mouse (Murine) (20), Rat (Rattus) (20), Zebrafish (Danio rerio) (18), Chicken (3), Xenopus laevis (3), Zebrafish (1)
Applications Immunofluorescence (IF) (14), Western Blotting (WB) (10), ELISA (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (2), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes C-Term (1), Center (1), N-Term (1)