Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Prostate Tumor Overexpressed 1 (PTOV1) antibody

Antigen

Prostate Tumor Overexpressed 1 (PTOV1)

Synonyms ACID2, MGC71475, DKFZp586I111
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN311328
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name PTOV1
Gene ID PTOV1
UniProt Q86YD1
Immunogen The immunogen for anti-PTOV1 antibody: synthetic peptide directed towards the N terminal of human PTOV1
Sequence DSTAKLKRTLPCQAYVNQGENLETDQWPQKLIMQLIPQQL LTTLGPLFRN
Cross-Reactivity Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-PTOV1 antibody concentration is 1 mg/ml.
Description PTOV1 belongs to the Mediator complex subunit 25 family, PTOV1 subfamily. It may activate transcription and is required for nuclear translocation of FLOT1. PTOV1 promotes cell proliferation.
Characteristics Antigen Size: 416 amino acids
Molecular Weight 47kDa

Application Details

Application Notes WB Suggested Anti-PTOV1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Cancer, Cell Cycle, Transcription Factors
Restrictions For Research Use only

Publications

Product Santamaría, Castellanos, Gómez et al.: "PTOV1 enables the nuclear translocation and mitogenic activity of flotillin-1, a major protein of lipid rafts." in: Molecular and cellular biology, Vol. 25, Issue 5, pp. 1900-11, 2005 (PubMed).

Alternatives

Alternatives for antigen "Prostate Tumor Overexpressed 1 (PTOV1)", type "Antibodies"
Hosts Rabbit (24)
Reactivities Human (24), Mouse (Murine) (20), Rat (Rattus) (19), Cow (Bovine) (1)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (9), ELISA (7), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (IHC) (2), Dot Blot (DB) (1), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1)
Epitopes N-Term (3), N-Term,AA 28-56 (1)