WD Repeat and FYVE Domain Containing 3 (WDFY3) antibody

Antigen: WD Repeat and FYVE Domain Containing 3 (WDFY3)

Synonyms: ALFY, ZFYVE25, KIAA0993, MGC16461

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN311364

Additional Information

Alternative name: WDFY3 / ALFY

Gene ID: WDFY3

UniProt: Q8IZQ1

Immunogen: The immunogen for anti-WDFY3 antibody: synthetic peptide directed towards the C terminal of human WDFY3

Sequence: EKLADAVRFLGCFSDLRKISAMNVFPSNTQPFQRLLEEDV ISIESVSPTL

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-WDFY3 antibody concentration is 1 mg/ml.

Description: WDFY3 is a protein which contains WD repeats and an FYVE domain. WDFY3 might target cytosolic protein aggregates for autophagic degradation.This gene encodes a protein which contains WD repeats and an FYVE domain. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.

Characteristics: Antigen Size: 795 amino acids

Molecular Weight: 90kDa

Application Details

Application Notes: WB Suggested Anti-WDFY3 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-WDFY3 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain

Publications

Product: Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).