Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

WD Repeat and FYVE Domain Containing 3 (WDFY3) antibody

Antigen

WD Repeat and FYVE Domain Containing 3 (WDFY3)

Synonyms ALFY, ZFYVE25, KIAA0993, MGC16461
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN311364
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name WDFY3 / ALFY
Gene ID WDFY3
UniProt Q8IZQ1
Immunogen The immunogen for anti-WDFY3 antibody: synthetic peptide directed towards the C terminal of human WDFY3
Sequence EKLADAVRFLGCFSDLRKISAMNVFPSNTQPFQRLLEEDV ISIESVSPTL
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-WDFY3 antibody concentration is 1 mg/ml.
Description WDFY3 is a protein which contains WD repeats and an FYVE domain. WDFY3 might target cytosolic protein aggregates for autophagic degradation.This gene encodes a protein which contains WD repeats and an FYVE domain. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.
Characteristics Antigen Size: 795 amino acids
Molecular Weight 90kDa

Application Details

Application Notes WB Suggested Anti-WDFY3 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).

Alternatives

Alternatives for antigen "WD Repeat and FYVE Domain Containing 3 (WDFY3)", type "Antibodies"
Hosts Rabbit (27), Mouse (1)
Reactivities Human (28), Mouse (Murine) (4), Rat (Rattus) (4), Cow (Bovine) (2), Dog (Canine) (2), Cat (Feline) (1), Chicken (1)
Applications Immunofluorescence (IF) (16), ELISA (10), Western Blotting (WB) (10), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes C-Term (1), Internal Region (1)