MICAL-Like 1 (MICALL1) antibody

Antigen: MICAL-Like 1 (MICALL1)

Synonyms: MIRAB13, FLJ45921, KIAA1668, MICAL-L1, DKFZp686M2226, mirab13, mical-l1

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN311441

Additional Information

Alternative name: MICAL-like protein 1

Gene ID: MICALL1

UniProt: Q8N3F8

Immunogen: The immunogen for anti-MICALL1 antibody: synthetic peptide directed towards the N terminal of human MICALL1

Sequence: ENGPEEGTFVCAEHCARLGPGTRSGTRPGPFSQPKQQHQQ QLAEDAKDVP

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-MICALL1 antibody concentration is 1 mg/ml.

Description: MICALL1 contains 1 CH (calponin-homology) domain and 1 LIM zinc-binding domain. It may be a cytoskeletal regulator.

Characteristics: Antigen Size: 863 amino acids

Molecular Weight: 93kDa

Application Details

Application Notes: WB Suggested Anti-MICALL1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-MICALL1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver

Publications

Product: Jin, Smith, Stark et al.: "Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization." in: Current biology : CB, Vol. 14, Issue 16, pp. 1436-50, 2004 (PubMed).