Chimerin (Chimaerin) 2 (CHN2) antibody

Antigen: Chimerin (Chimaerin) 2 (CHN2)

Synonyms: BCH, ARHGAP3, RHOGAP3, MGC138360, Bch, 1700026N20Rik, 4930557O16Rik, MGC82782, MGC137510

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN311468

Additional Information

Alternative name: ARHGAP3 / CHN2

Gene ID: CHN2

UniProt: P52757

Immunogen: The immunogen for anti-CHN2 antibody: synthetic peptide directed towards the N terminal of human CHN2

Sequence: AFGVKVGVKGGFLWPPLKLFACSQISSLVRRAALTHNDNH FNYEKTHNFK

Cross-Reactivity: Cow (Bovine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-CHN2 antibody concentration is 1 mg/ml.

Description: CHN2 is a protein with a phorbol-ester/DAG-type zinc finger, a Rho-GAP domain and an SH2 domain. This protein has GTPase-activating protein activity that is regulated by phospholipid binding and binding of diacylglycerol (DAG) induces translocation of the protein from the cytosol to the Golgi apparatus membrane. CHN2 plays a role in the proliferation and migration of smooth muscle cells. Decreased expression of this gene is associated with high-grade gliomas and breast tumors, and increased expression of this gene is associated with lymphomas. Mutations in this gene have been associated with schizophrenia in men.This gene is a member of the chimerin family and encodes a protein with a phorbol-ester/DAG-type zinc finger, a Rho-GAP domain and an SH2 domain. This protein has GTPase-activating protein activity that is regulated by phospholipid binding and binding of diacylglycerol (DAG) induces translocation of the protein from the cytosol to the Golgi apparatus membrane. The protein plays a role in the proliferation and migration of smooth muscle cells. Decreased expression of this gene is associated with high-grade gliomas and breast tumors, and increased expression of this gene is associated with lymphomas. Mutations in this gene have been associated with schizophrenia in men. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Characteristics: Antigen Size: 332 amino acids

Molecular Weight: 38kDa

Application Details

Application Notes: WB Suggested Anti-CHN2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-CHN2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver

Publications

Product: Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).