Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Calponin 2 (CNN2) antibody

Antigen

Calponin 2 (CNN2)
Synonyms AA408047, AI324678, cnn2, MGC53326, CNN2, Calponin-2, wz2414, fb36d03, fb93a05, zgc:65794, wu:fb36d03, wu:fb93a05, MGC82320, MGC127599, MGC108411, DKFZp468N0916, MGC69240
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Chicken, Xenopus laevis, Zebrafish
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN311484
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Calponin 2 (CNN2) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name Calponin-2
Gene ID CNN2
UniProt Q99439
Immunogen The immunogen for anti-CNN2 antibody: synthetic peptide directed towards the N terminal of human CNN2
Sequence MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEG LTGLSIGPDF
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-CNN2 antibody concentration is 1 mg/ml.
Description CNN2, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. CNN2 could play a role in smooth muscle contraction and cell adhesion.The protein encoded by this gene, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. The encoded protein could play a role in smooth muscle contraction and cell adhesion. Two transcript variants encoding different isoforms have been found for this gene.
Characteristics Antigen Size: 309 amino acids
Molecular Weight 34kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-CNN2 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Gevaert, Goethals, Martens et al.: "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides." in: Nature biotechnology, Vol. 21, Issue 5, pp. 566-9, 2003 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "Calponin 2 (CNN2)", type "Antibodies"
Hosts Rabbit (42), Goat (3), Mouse (1)
Reactivities Human (44), Mouse (Murine) (23), Rat (Rattus) (3), Chicken (2), Cow (Bovine) (2), Dog (Canine) (2), Cat (Feline) (1), Monkey (1), Pig (Porcine) (1), Xenopus laevis (1), Zebrafish (1)
Applications Western Blotting (WB) (31), ELISA (26), Immunofluorescence (IF) (21), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (5), Immunohistochemistry (IHC) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Flow Cytometry (FACS) (2), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes N-Term (9), Center (2), Internal Region (2), N-Term,Ser24 (1)