Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311495

Ret Finger Protein-Like 2 (RFPL2) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RNF79, RFPL2
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311495
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RFPL2 antibody: synthetic peptide directed towards the C terminal of human RFPL2
Sequence VSFFDAESGSHVYTFRSVSAEEPLRPFLAPSVPPNGDQGV LSICPLMNSG
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against RFPL2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RFPL2
Background RFPL2 contains 1 B30.2/SPRY domain and 1 RING-type zinc finger. The human RFPL2 gene has a role in neocortex development.
Molecular Weight 32kDa
Gene ID 10739
NCBI Accession NP_001091997, NM_001098527
UniProt O75678
Research Area Neurology, Proteolysis / Ubiquitin
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RFPL2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Alternatives for antigen "Ret Finger Protein-Like 2 (RFPL2)", type "Antibodies"
Hosts (6), (1)
Reactivities (5)
Applications (4), (2), (1)
Epitopes (2)
Beacon