Ret Finger Protein-Like 2 (RFPL2) antibody

Antigen: Ret Finger Protein-Like 2 (RFPL2)

Synonyms: RNF79, RFPL2

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN311495

Additional Information

Alternative name: RFPL2 / RNF79

Gene ID: RFPL2

UniProt: O75678

Immunogen: The immunogen for anti-RFPL2 antibody: synthetic peptide directed towards the C terminal of human RFPL2

Sequence: VSFFDAESGSHVYTFRSVSAEEPLRPFLAPSVPPNGDQGV LSICPLMNSG

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-RFPL2 antibody concentration is 1 mg/ml.

Description: RFPL2 contains 1 B30.2/SPRY domain and 1 RING-type zinc finger. The human RFPL2 gene has a role in neocortex development.

Characteristics: Antigen Size: 288 amino acids

Molecular Weight: 32kDa

Application Details

Application Notes: WB Suggested Anti-RFPL2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-RFPL2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver

Publications

Product: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).