Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

TP53 Target 5 (TP53TG5) antibody

Antigen

TP53 Target 5 (TP53TG5)

Synonyms CLG01, C20orf10, TP53TG5
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN311624
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name TP53TG5
Gene ID C20orf10
UniProt Q9Y2B4
Immunogen The immunogen for anti-C20orf10 antibody: synthetic peptide directed towards the N terminal of human C20orf10
Sequence RLRTVLKNLSLLKLLKSSNRRIQELHKLAKRCWHSLLSVP KILRISSGEN
Cross-Reactivity Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-C20orf10 antibody concentration is 1 mg/ml.
Description The exact function of C20orf10 remains unknown.
Characteristics Antigen Size: 290 amino acids
Molecular Weight 32kDa

Application Details

Application Notes WB Suggested Anti-C20orf10 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Deloukas, Matthews, Ashurst et al.: "The DNA sequence and comparative analysis of human chromosome 20." in: Nature, Vol. 414, Issue 6866, pp. 865-71, 2002 (PubMed).

Alternatives

Alternatives for antigen "TP53 Target 5 (TP53TG5)", type "Antibodies"
Hosts Rabbit (22)
Reactivities Human (20), Dog (Canine) (17), Mouse (Murine) (17), Rat (Rattus) (17)
Applications Immunofluorescence (IF) (14), Western Blotting (WB) (7), ELISA (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (2), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes Internal Region (1), N-Term (1)