Tetratricopeptide Repeat Domain 12 (TTC12) antibody

Antigen: Tetratricopeptide Repeat Domain 12 (TTC12)

Synonyms: TPARM, FLJ13859, FLJ20535

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Rat (Rattus), Mouse (Murine)

Application: Western Blotting (WB)

Catalog no.: ABIN311633

Additional Information

Alternative name: TTC12

Gene ID: TTC12

UniProt: B0YJB4

Immunogen: The immunogen for anti-TTC12 antibody: synthetic peptide directed towards the C terminal of human TTC12

Sequence: MNLCLQAPFVSEVWAVEVSRRCLSLLNSQDGGILTRAAGV LSRTLSSSLK

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TTC12 antibody concentration is 1 mg/ml.

Description: TTC12 contains 3 TPR repeats. Hypermethylation of TTC12 gene may play a role in acute lymphoblastic leukemia. Haplotypic variants in DRD2, ANKK1, TTC12, and NCAM1 are associated with comorbid alcohol and drug dependence.

Characteristics: Antigen Size: 732 amino acids

Molecular Weight: 81kDa

Application Details

Application Notes: WB Suggested Anti-TTC12 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Muscle.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TTC12 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Muscle

Publications

Product: Yang, Kranzler, Zhao et al.: "Association of haplotypic variants in DRD2, ANKK1, TTC12 and NCAM1 to alcohol dependence in independent case control and family samples." in: Human molecular genetics, Vol. 16, Issue 23, pp. 2844-53, 2007 (PubMed).