Calmin (CLMN) antibody

Antigen: Calmin (CLMN)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN311650

Additional Information

Alternative name: Calmin

Gene ID: CLMN

UniProt: Q96JQ2

Immunogen: The immunogen for anti-CLMN antibody: synthetic peptide directed towards the C terminal of human CLMN

Sequence: LEENVTKESISSKKKEKRKHVDHVESSLFVAPGSVQSSDD LEEDSSDYSI

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-CLMN antibody concentration is 1 mg/ml.

Description: CLMN is a single-pass type IV membrane protein. It contains 1 actin-binding domain and 2 CH (calponin-homology) domains. The exact function of CLMN remains unknown.

Characteristics: Antigen Size: 1002 amino acids

Molecular Weight: 110kDa

Application Details

Application Notes: WB Suggested Anti-CLMN Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-CLMN Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver

Publications

Product: Heilig, Eckenberg, Petit et al.: "The DNA sequence and analysis of human chromosome 14." in: Nature, Vol. 421, Issue 6923, pp. 601-7, 2003 (PubMed).