Chromosome 7 Open Reading Frame 61 (C7orf61) antibody

Antigen: Chromosome 7 Open Reading Frame 61 (C7orf61)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN311676

Additional Information

Alternative name: C7orf61

Gene ID: C7orf61

Immunogen: The immunogen for anti-C7orf61 antibody: synthetic peptide directed towards the C terminal of human LOC402573

Sequence: YLVLWAVRKHLRRLYRRQERHRRHHVRCHAAPRPNPAQSL KLDAQSPL

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-C7orf61 antibody concentration is 1 mg/ml.

Description: The exact function of LOC402573 remains unknown.

Characteristics: Antigen Size: 206 amino acids

Molecular Weight: 24kDa

Application Details

Application Notes: WB Suggested Anti-C7orf61 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-C7orf61 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain

Publications

Product: Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).