Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311677

Golgin A7 Family, Member B (GOLGA7B) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C10orf132, C10orf133, bA451M19.3, bA459F3.4, 4933417O08Rik, AI839934
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311677
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C10orf132 antibody: synthetic peptide directed towards the N terminal of human C10orf132
Sequence MATEVHNLQELRRSASLATKVFIQRDYSDGTICQFQTKFP PELDSRIERQ
Predicted Reactivity Bovine :100%,   Mouse :100%,   Human :100%,   Zebrafish :92%,   Green puffer :85%,   Southern house mosquito :78%,   Florida lancelet :78%,   Yellowfever mosquito :78%,  
Characteristics This is a rabbit polyclonal antibody against C10orf132. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C10orf132
Background The exact function of C10orf132 remains unknown.
Molecular Weight 18kDa
Gene ID 401647
NCBI Accession NP_001010917, NM_001010917
UniProt Q2TAP0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C10orf132 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).

Alternatives for antigen "Golgin A7 Family, Member B (GOLGA7B)", type "Antibodies"
Hosts (16)
Reactivities (15), (12), (12), (12), (12), (12), (12)
Applications (10), (7), (4), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3)
Beacon