Golgin A7 Family, Member B (GOLGA7B) (N-Term) antibody

Details for Product No. ABIN311677
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms C10orf132, C10orf133, bA451M19.3, bA459F3.4, 4933417O08Rik, AI839934
Epitope
N-Term
(3)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Human
(15), (12), (12), (12), (12), (12), (12)
Host
Rabbit
(16)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (7), (3), (3)
Pubmed 1 reference available
Catalog no. ABIN311677
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human C10orf132
Sequence MATEVHNLQELRRSASLATKVFIQRDYSDGTICQFQTKFP PELDSRIERQ
Predicted Reactivity Bovine :100 %,   Mouse :100 %,   Human :100 %,   Zebrafish :90 %,   Green puffer :80 %,   Southern house mosquito :70 %,   Florida lancelet :70 %,   Yellowfever mosquito :70 %,  
Characteristics This is a rabbit polyclonal antibody against C10orf132. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C10orf132
Background The exact function of C10orf132 remains unknown.
Molecular Weight 18 kDa
Gene ID 401647
NCBI Accession NM_001010917, NP_001010917
UniProt Q2TAP0
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 167 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Golgin A7 Family, Member B (GOLGA7B) (N-Term) antibody WB Suggested Anti-C10orf132 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysate
Background publications Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10...." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).

Hosts (16)
Reactivities (15), (12), (12), (12), (12), (12), (12)
Applications (10), (7), (3), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3)
back to top