Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Golgin A7 Family, Member B (GOLGA7B) antibody

Antigen

Golgin A7 Family, Member B (GOLGA7B)

Synonyms C10orf132, C10orf133, MGC131701, bA459F3.4, bA451M19.3, MGC142751, AI839934, 4933417O08Rik, RP23-470C16.1
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Zebrafish

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN311677
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name GOLGA7B
Gene ID C10orf132
UniProt Q2TAP0
Immunogen The immunogen for anti-C10orf132 antibody: synthetic peptide directed towards the N terminal of human C10orf132
Sequence MATEVHNLQELRRSASLATKVFIQRDYSDGTICQFQTKFP PELDSRIERQ
Cross-Reactivity Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-C10orf132 antibody concentration is 1 mg/ml.
Description The exact function of C10orf132 remains unknown.
Characteristics Antigen Size: 167 amino acids
Molecular Weight 18kDa

Application Details

Application Notes WB Suggested Anti-C10orf132 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).

Alternatives

Alternatives for antigen "Golgin A7 Family, Member B (GOLGA7B)", type "Antibodies"
Hosts Rabbit (22)
Reactivities Human (21), Cow (Bovine) (18), Mouse (Murine) (18), Rat (Rattus) (18)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (7), ELISA (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes N-Term (3)