Activating Transcription Factor 6 beta (ATF6B) antibody

Antigen: Activating Transcription Factor 6 beta (ATF6B)

Synonyms: G13, CREBL1, CREB-RP, FLJ10066, Crebl1, MGC112556, ATF6B, DKFZp468D128

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Pig (Porcine)

Application: Western Blotting (WB)

Catalog no.: ABIN404752

Additional Information

Alternative name: ATF6 beta

Gene ID: CREBL1

UniProt: Q99941

Immunogen: The immunogen for anti-CREBL1 antibody: synthetic peptide directed towards the middle region of human CREBL1

Sequence: FNRTESLRLADELSGWVQRHQRGRRKIPQRAQERQKSQPR KKSPPVKAVP

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-CREBL1 antibody concentration is 1 mg/ml.

Description: ATF6B(CREBL1) is a transcription factor in the unfolded protein response (UPR) pathway during ER stress. Either as a homodimer or as a heterodimer with ATF6-alpha, the protein binds to the ER stress response element, interacting with nuclear transcription factor Y to activate UPR target genes. ATF6B is normally found in the membrane of the endoplasmic reticulum, however, under ER stress, the N-terminal cytoplasmic domain is cleaved from the rest of the protein and translocates to the nucleus. Two transcript variants encoding different isoforms have been found for this gene.The protein encoded by this gene bears sequence similarity with the Creb/ATF subfamily of the bZip superfamily of transcription factors. It localizes to both the cytoplasm and the nucleus. The gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 703 amino acids

Molecular Weight: 77kDa

Application Details

Application Notes: WB Suggested Anti-CREBL1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Muscle.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-CREBL1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Muscle

Publications

Product: Xie, Rowen, Aguado et al.: "Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse." in: Genome research, Vol. 13, Issue 12, pp. 2621-36, 2003 (PubMed).