Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

CKLF-Like MARVEL Transmembrane Domain Containing 2 (CMTM2) antibody

Antigen

CKLF-Like MARVEL Transmembrane Domain Containing 2 (CMTM2)
Synonyms CKLFSF2, MGC39436
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
2 references available
Catalog no. ABIN404753
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-CKLF-Like MARVEL Transmembrane Domain Containing 2 (CMTM2) antibody

Additional Information
Application Details Publications Images Alternatives back to top

Alternative name CMTM2
Gene ID CMTM2
UniProt Q8TAZ6
Immunogen The immunogen for anti-CMTM2 antibody: synthetic peptide directed towards the N terminal of human CMTM2
Sequence DKPQKAVQDHKEPSDKPQKAVQPKHEVGTRRGCRRYRWEL KDSNKEFWLL
Cross-Reactivity Cow (Bovine), Human, Mouse (Murine)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-CMTM2 antibody concentration is 1 mg/ml.
Description CMTM2 belongs to the chemokine-like factor superfamily, a novel family that links the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein may play an important role in testicular development. This gene belongs to the chemokine-like factor gene superfamily, a novel family that links the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein encoded by this gene may play an important role in testicular development.
Characteristics Antigen Size: 248 amino acids
Molecular Weight 27kDa

Application Details
Publications Images Alternatives back to top

Application Notes WB Suggested Anti-CMTM2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Placenta.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Stem Cells
Restrictions For Research Use only

Publications
Application Details Images Alternatives back to top

Product Fan, Liu, Hao et al.: "Crystal structure of uroporphyrinogen decarboxylase from Bacillus subtilis." in: Journal of bacteriology, Vol. 189, Issue 9, pp. 3573-80, 2007 (PubMed).

Liu, Xin, Chen et al.: "Expression and localization of CKLFSF2 in human spermatogenesis." in: Asian journal of andrology, Vol. 9, Issue 2, pp. 189-98, 2007 (PubMed).

Alternatives
Application Details Publications Images back to top

Alternatives for antigen "CKLF-Like MARVEL Transmembrane Domain Containing 2 (CMTM2)", type "Antibodies"
Hosts Rabbit (57)
Reactivities Mouse (Murine) (36), Human (20), Rat (Rattus) (18)
Applications Immunofluorescence (IF) (45), Western Blotting (WB) (12), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (9), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (9), ELISA (8), Immunoelectron Microscopy (IEM) (3), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (3), Alexa Fluor 488 (3), Alexa Fluor 555 (3), Alexa Fluor 647 (3), Biotin (3), Cy3 (3), Cy5 (3), Cy5.5 (3), Cy7 (3), FITC (3), Gold (3), HRP (3), PE (3), PE-Cy3 (2), PE-Cy5 (2), PE-Cy5.5 (2), PE-Cy7 (2), Un-conjugated (2), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes Isoform 1 (18), C-Term (1), N-Term (1)