LIM Domain Binding 2 (LDB2) antibody

Antigen: LIM Domain Binding 2 (LDB2)

Synonyms: LDB1, CLIM1, Ldb3, CLP-36, AI035351, AW146358, LDB2, CLIM-1, MGC127025

Clonality: Polyclonal

Host: Rabbit

Reactivity: Chicken, Human, Rat (Rattus), Mouse (Murine)

Application: Western Blotting (WB)

Catalog no.: ABIN404792

Additional Information

Alternative name: LDB2

Gene ID: LDB2

UniProt: O43679

Immunogen: The immunogen for anti-LDB2 antibody: synthetic peptide directed towards the middle region of human LDB2

Sequence: LENTQYDAANGMDDEEDFNNSPALGNNSPWNSKPPATQET KSENPPPQAS

Cross-Reactivity: Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-LDB2 antibody concentration is 1 mg/ml.

Description: LDB2 belongs to the LDB family. LDB2 binds to the LIM domain of a wide variety of LIM domain-containing transcription factors. LIM domains are required for both inhibitory effects on LIM homeodomain transcription factors and synergistic transcriptional activation events. The inhibitory actions of the LIM domain can often be overcome by the LIM co-regulators known as CLIM2, LDB2 and NLI. LIM homeoproteins and CLIMs are involved in a variety of developmental processes.

Characteristics: Antigen Size: 373 amino acids

Molecular Weight: 43kDa

Application Details

Application Notes: WB Suggested Anti-LDB2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Small Intestine.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-LDB2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Small Intestine

Publications

Product: Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).