Sirtuin 4 (SIRT4) antibody

Antigen: Sirtuin 4 (SIRT4)

Synonyms: SIR2L4, MGC57437, MGC130046, MGC130047, SIRT4, MGC138990, MGC103539, MGC191927, im:7139453

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN404803

Additional Information

Alternative name: SIRT4

Gene ID: SIRT4

UniProt: Q9Y6E7

Immunogen: The immunogen for anti-SIRT4 antibody: synthetic peptide directed towards the N terminal of human SIRT4

Sequence: ASPPLDPEKVKELQRFITLSKRLLVMTGAGISTESGIPDY RSEKVGLYAR

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SIRT4 antibody concentration is 1 mg/ml.

Description: SIRT4 is a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined, however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. SIRT4 is included in class IV of the sirtuin family. This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined, however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class IV of the sirtuin family.

Characteristics: Antigen Size: 314 amino acids

Molecular Weight: 35kDa

Application Details

Application Notes: WB Suggested Anti-SIRT4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Small Intestine.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Metabolism, Proteases

Restrictions: For Research Use only

Images

WB Suggested Anti-SIRT4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Small Intestine

Publications

Product: Ahuja, Schwer, Carobbio et al.: "Regulation of insulin secretion by SIRT4, a mitochondrial ADP-ribosyltransferase." in: The Journal of biological chemistry, Vol. 282, Issue 46, pp. 33583-92, 2007 (PubMed).