Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Poly (ADP-Ribose) Polymerase Family, Member 16 (PARP16) antibody

Antigen

Poly (ADP-Ribose) Polymerase Family, Member 16 (PARP16)

Synonyms LRRGT00109, RGD1306243, PARP16, MGC142706, C15orf30, FLJ20509, FLJ25281, C79952, BC055447, MGC65335, MGC77744
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN404894
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name PARP16
Gene ID PARP16
UniProt Q8N5Y8-3
Immunogen The immunogen for anti-PARP16 antibody: synthetic peptide directed towards the middle region of human PARP16
Sequence PKYFVVTNNQLLRVKYLLVYSQKPPKSRASSQLSWFSSHW FTVMISLYLL
Cross-Reactivity Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-PARP16 antibody concentration is 1 mg/ml.
Description Poly(ADP-ribosyl)ation is an immediate DNA-damage-dependent post-translational modification of histones and other nuclear proteins that contributes to the survival of injured proliferating cells. PARP16 is a member of poly(ADP-ribose) polymerases (PARPs) family that is encoded by different genes and displaying a conserved catalytic domain in which PARP-1 (113 kDa), the founding member, and PARP-2 (62 kDa) are so far the sole enzymes whose catalytic activity has been shown to be immediately stimulated by DNA strand breaks. A large repertoire of sequences encoding novel PARPs now extends considerably the field of poly(ADP-ribosyl)ation reactions to various aspects of the cell biology including cell proliferation and cell death. Some of these new members interact with each other, share common partners and common subcellular localizations suggesting possible fine tuning in the regulation of this post-translational modification of proteins.
Characteristics Antigen Size: 323 amino acids
Molecular Weight 36kDa

Application Details

Application Notes WB Suggested Anti-PARP16 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling
Restrictions For Research Use only

Publications

Product Amé, Spenlehauer, de Murcia: "The PARP superfamily." in: BioEssays : news and reviews in molecular, cellular and developmental biology, Vol. 26, Issue 8, pp. 882-93, 2004 (PubMed).

Alternatives

Alternatives for antigen "Poly (ADP-Ribose) Polymerase Family, Member 16 (PARP16)", type "Antibodies"
Hosts Rabbit (30), Mouse (2)
Reactivities Human (28), Mouse (Murine) (21), Rat (Rattus) (19), Dog (Canine) (18), Cow (Bovine) (1)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (15), ELISA (10), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Flow Cytometry (FACS) (2), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes C-Term (4), N-Term (4), Internal Region (1)