TCDD-Inducible Poly(ADP-Ribose) Polymerase (Tiparp) antibody

Antigen: TCDD-Inducible Poly(ADP-Ribose) Polymerase (Tiparp)

Synonyms: PARP7, AW558171, TIPARP, sb:cb841, MGC153056, zgc:153056, si:dkey-33k14.4, ddf1, parp7, parp-1, parp-7

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN404897

Additional Information

Alternative name: TIPARP

Gene ID: TIPARP

UniProt: Q7Z3E1

Immunogen: The immunogen for anti-TIPARP antibody: synthetic peptide directed towards the N terminal of human TIPARP

Sequence: LKTCFKKKDQKRLGTGTLRSLRPILNTLLESGSLDGVFRS RNQSTDENSL

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TIPARP antibody concentration is 1 mg/ml.

Description: TIPARP is a poly [ADP-ribose] polymerase using NAD+ as a substrate to transfer ADP-ribose onto glutamic acid residues of a protein acceptor, repeated rounds of ADP-ribosylation leads to the formation of poly(ADPribose) chains on the protein, thereby altering the function of the target protein. TIPARP may play a role in the adaptative response to chemical exposure (TCDD) and thereby mediates certain effects of the chemicals.

Characteristics: Antigen Size: 657 amino acids

Molecular Weight: 76kDa

Application Details

Application Notes: WB Suggested Anti-TIPARP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TIPARP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart

Publications

Product: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).