Sex Comb On Midleg-Like 1 (Drosophila) (SCML1) antibody

Antigen: Sex Comb On Midleg-Like 1 (Drosophila) (SCML1)

Synonyms: SCML1

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN405019

Additional Information

Alternative name: SCML1

Gene ID: SCML1

UniProt: Q5H968

Immunogen: The immunogen for anti-SCML1 antibody: synthetic peptide directed towards the middle region of human SCML1

Sequence: ESYSPTLPVSRRENNSPSNLPRPSFCMEEYQRAELEEDPI LSRTPSPVHP

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SCML1 antibody concentration is 1 mg/ml.

Description: The function of SCML1 remains unknown.

Characteristics: Antigen Size: 302 amino acids

Molecular Weight: 34kDa

Application Details

Application Notes: WB Suggested Anti-SCML1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Hela cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-SCML1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Hela cell lysate

anti-Sex Comb On Midleg-Like 1 (Drosophila) (SCML1) antibody (Image 2)

Publications

Product: Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).